PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004983.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 426aa    MW: 47234.2 Da    PI: 7.2881
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004983.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-093473812155
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Aco004983.1 347 KWPYPSETEKVALAESTGLDQKQINNWFINQRKRH 381
                  669*****************************885 PP

2ELK35.22.7e-12301322122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK++Ll+KYsgyL+sL+qE+s
  Aco004983.1 301 ELKQHLLKKYSGYLSSLRQELS 322
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.1E-19123167IPR005540KNOX1
PfamPF037901.2E-20124166IPR005540KNOX1
SMARTSM012562.5E-29173224IPR005541KNOX2
PfamPF037912.0E-24178223IPR005541KNOX2
SMARTSM011885.6E-7301322IPR005539ELK domain
PfamPF037891.5E-9301322IPR005539ELK domain
PROSITE profilePS5121311.348301321IPR005539ELK domain
PROSITE profilePS5007112.876321384IPR001356Homeobox domain
SuperFamilySSF466891.97E-19322397IPR009057Homeodomain-like
SMARTSM003891.0E-12323388IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-27326386IPR009057Homeodomain-like
CDDcd000862.21E-11333385No hitNo description
PfamPF059201.7E-16341380IPR008422Homeobox KN domain
PROSITE patternPS000270359382IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MEEYSLLGGS NCNSSRGATN ANTNAITTNS FMYLPSSTAI GAAAAAAAAT TPPPSPPPHV  60
VVAPPHISGQ YGRSYQYPHR FINQPLKAEA GPSTTQYPPL ERGAILLEHG GGARQETSPR  120
EEEALKAKIM SHPQYSTLLG AYLDCQKVGA PQEVVDRLTV MAREFERRCP SGGRHDLSTD  180
PELDQFMEAY YNMLVKYREE LTRPIQEATE FLKRVESQLN SLTNGASSRF FTPGQGFKCQ  240
STQARTKYIR LFLVIALTCS LFAPLESADD KCEGVGSSEE DRDASGEGEA PEIDPRAEDK  300
ELKQHLLKKY SGYLSSLRQE LSKKKKKGKL PKDARQKLLS WWELHYKWPY PSETEKVALA  360
ESTGLDQKQI NNWFINQRKR HWKPSEDMQF VVMDGFHPQN AAAAAAAALY MDGQFTGDGM  420
YRLGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6623261e-171KM662326.1 Ananas bracteatus clone 45967 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943406.11e-148PREDICTED: homeotic protein knotted-1-like
SwissprotO041351e-134KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLI0IUH91e-138I0IUH9_9ASPA; Class I knotted1-like homeobox protein
STRINGVIT_18s0001g08380.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-104KNOTTED-like from Arabidopsis thaliana